dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q4V914 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q4V914|Q4V914_DANRE) Core histone macro-H2A {ECO:0000256|PIRNR:PIRNR037942} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=zgc:114051 OC=Cyprinidae; Danio.
Sequence length 367
Sequence
MSARGGKKKITKLSRSARAGVIFPVGRMMRYLRTGTHKYRIGMGAPVYMAAVIEYLAAEI
LELAGNAARDNKKGRITPRHIKLAVANDEELNQLLRGVTISNGGVLPRIHPELLSKKRGG
KVKVESQVAVPEKSAKRKPVKKPYKKSKGKPGRKPKKSTENDKEADANAMEDGPGEGFTI
LSAKSLFLGQKLSLTESEISKIGTIKVEGIINPTNAEIDLKEGIGNALEKTGGKDFLETV
KELRKSQGPLEVASVAVSQANGMAARFIIHCHVPQWGSDKCEDQLEKTVKNCLSAAEEKK
LKSVAFPSLPAGRNGFPKQTAAQLILKAISNHFVSATTSSLKNIYFVLFDSESIGIYLQE
MAKMDAK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]