dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q56P27 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|Q56P27|NIP7_PIG) 60S ribosome subunit biogenesis protein NIP7 homolog KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=NIP7; OC=Sus.
Sequence length 180
Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKILKLAANISG
DKLMSLGTCFGKFTKTHKFRLHITALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]