dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q5BFH3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|Q5BFH3|XRN2_EMENI) 5'-3' exoribonuclease 2 KW=Complete proteome; Reference proteome OX=227321 OS=194 / M139) (Aspergillus nidulans). GN=rat1; OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence length 1032
Sequence
MGVPALFRWLSKKYPKIISSVIEELPQEVNGEEIPVDITGPNPNGEEMDNLYLDMNGIVH
PCTHPEGKPPPANEQEMMIEIFKYTDRVVNMVRPRKLLMIAVDGVAPRAKMNQQRARRFR
SAQEAREQDEKKQEFQRMLAKQNGDKEQMLQEEVIQKTWDSNVITPGTPFMDILAASLRY
WIAYKLNTDPAWEKLKIIISDATVPGEGEHKIMEFIRSQRASPEHDPNARHVIYGLDADL
IMLGLATHEPHFRVLREDVFFQESKQRTCHLCGQPGHKAEECRGQAKEKNGEFDEKGKGA
TLKPFIWLHVSILREYLAAELYVPHQPFPFDLERALDDWVFMCFFVGNDFLPHLPSLDIR
EDGIDTLIAIWRDNIPLMGGYLTQDGRVDLKKAQLILQGLAKQEDAIFRRRRQAEERKLA
NEKRRKQEEKARNEERARKRRRSSPSYDAIESPTHAKPRSAGAAAAPPAGLELITPARGE
LARQTRELTHSMVVNRGNVYRANMANKSAAAVLKSKLLGGQDGQPSDDGESTAESDAQLD
AAGPVLGKRKADEAEVGQLGTETPDKPEPAKADELPPDTVRLWEEGYADRYYEQKFGVDP
QDKEFRHKVARAYAEGLAWVLLYYFQGCPSWTWYYPYHYAPFAADFVDIGDMELSFEKGT
PFKPYEQLMGVLPASSNHAIPKVFHSLMTEPDSEIIDFYPEDFPVDLNGKKFAWQGVVLL
PFIDEKRLLAAMSKKYPLLTEDEKARNTVGRDVLLLSESHPLYQDLVSNFYSKKQGAPKY
KLNMRVSDGLAGKVEKNEAYIPHSSLVSSLEEYGMPSLEDDRSIMVNYEIPKSTNIHKSM
LLRGVKFGPPALDNADIQATKSRAQHSGRSYGGAPFRGGRGGRMNYAGDRQSHGNDRPNP
FAAHLDPKFMPGANPGAPMGMPSGWVPPSGNFSRGPPPPPRGGTSYGYGSQQYGSYGGYG
QQQSYQQSSHSQSDYYGRGPPAPYNNGPADYYSGRPSGYGPQESRGGGYNRGGYRGGRDT
YSSSGHGGYGRY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]