dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q5LBR3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q5LBR3|Q5LBR3_BACFN) Uncharacterized protein {ECO:0000313|EMBL:CAH08455.1} KW=Complete proteome; Reference proteome OX=272559 OS=NCTC 9343). GN=BF9343_2674 OC=Bacteroides.
Sequence length 99
Sequence
MLCQNSPQSSTEQSITEQSITEFFTTNQQLKIVSVLLCVLCGEYGHTSESPAEKVFGSLI
IAKEIEKRVPAINQSVLFLFILVDNNGEKVVKIYTLTNK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]