dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q6ZKW7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q6ZKW7|Q6ZKW7_ORYSJ) cDNA clone:J013162L02, full insert sequence {ECO:0000313|EMBL:BAG91108.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OJ1014_H11.14 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence length 1024
Sequence
MGGVSGKLVWVLLVMCSSWLIAAVHAQQAATTDPIEVAALEAILGRWGKTTSPLWRMSGE
PCRGVPVDGSTDLDGNPKNNPGIKCDCSYNSGTVCHITQLRVYALNVVGQIPAELQNLTY
LTYLNLDQNYLSGPIPSFIGQLTALTELHVGFNPLSGSLPKELGNLTNLNLLGISLTNFS
GQLPEELGNLTKLRQLYTDSAGLSGPFPSTLSRLKNLKLLRASDNNFTGTIPDFIGSLSN
LEDLAFQGNSFEGPIPASLSNLTKLTTLRIGDIVNGSSSLAFISSLTSLDTLVLRNCKIS
GDLGAVDFSKFANLTFLDLSFNNISGNVPKSILNLQKLIFLFLGNNSLTGELPDGISPSL
TNLDFSYNQLTGSFPSWVTQNNLQLNLVANNFILGSTNIGMLPPGLNCLQEDTPCFRGSP
KYYSFAVDCGSNRSIRVSDNTMYELDSTNLGDSSYYVTSQTRWGVSNVGKLFQAPNDSKI
IHSGEKIQNAVDSELFQTARMSPSSLRYYGLGLENGNYTVLLKFAELGFPDTPTWQSLGR
RFFDIYIQGELKEKDFNIRKMAGGKSFTAVYKSYTTTVSKNFLEIHLFWAGKGTCCIPIQ
GYYGPLISALSITPNFSPTVRNGVPKKKSKAGAIVGIVIAASVLGSAILFGIFMVIKKRR
RMAKQQEELYNLVGQPDVFSNAELKLATDNFSSQNILGEGGYGPVYKGVLPDGRVIAVKQ
LSQSSHQGKSQFVTEVATISAVQHRNLVKLHGCCIDSNTPLLVYEYLKNGSLDKALFGNG
SIKLDWATRFEIILGIARGLTYLHEESSVRIVHRDIKASNVLLDTDLTPKISDFGLAKLY
DEKKTHVSTGIAGTFGYLAPEYAMRRHLTEKVDVFAFGVVALEIVAGRSNTDNSLEESKI
YLFEWAWSLYEKEQALGIVDPRLEEFSRDEVYRVIHVALICTQGSPYQRPPMSKVVAMLT
GDVEVAEVVTKPNYITEWQFRGGNTSYVTSHSGSTTPKLSRQKEIDPLTQSPTITGVSHE
HEGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]