dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q7MEF9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q7MEF9|Q7MEF9_VIBVY) Uncharacterized conserved protein {ECO:0000313|EMBL:BAC96737.1} KW=Complete proteome; Reference proteome OX=196600 OS=Vibrio vulnificus (strain YJ016). GN=VVA0711 OC=Vibrionaceae; Vibrio.
Sequence length 184
Sequence
MSQEHLSQDHEYEEEQFGEEIEIEAIGVEVSVQPIELYKVFKIANLVSGGGEAKHVIAEG
YVAVNGELETRKRRKMYDGDFFEFNQEYYVVVCDAPVTEPETEQEKAEKKTQKQAQAARK
EKSRQSKNAKPKGTGPKSTGRKAAHKERKAQKEALSQSAKKGQKAEKPQATRDPKSGRNS
IDFF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]