dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q8DHF5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q8DHF5|Q8DHF5_THEEB) Tll2004 protein {ECO:0000313|EMBL:BAC09556.1} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tll2004 OC=Thermosynechococcus.
Sequence length 390
Sequence
MEKAFSYRFYPTTEQESLLRRTLGCVRLVYNRALAARTEAWYERKERLDYVQTSALLTKW
KKQDDLQFLNEVSSVPLQQALRHLQSAFSNFFAGRAKYPNFKKKRNGGSAEFTKSAFRWK
DGKVFLAKCNEPPNILWSRRLPDGVEPSTVTIRLNPAGQWYISLRFDDPRDLTLQPVDPS
VGLDVGMSSLITLSTGEKIANPKHFNRYYKRLRKAQRSLSRKQKGSRNWDKARLKVAKIH
QKISDSRKDHLHQLTTRLIRENQTIIIESLAVKNMVKNRQLARSISDAGWGELVRQLEYK
AQWYGRTLVKIDQWFPSSKRCGQCGHIVERLPLSVREWDCPKCGAHHDRDVNAAQNILAV
GHTVTVCGAGVRPDRHTSGGQLRRSRKSQK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]