dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q8DIH2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|Q8DIH2|TILS_THEEB) tRNA(Ile)-lysidine synthetase {ECO:0000255|HAMAP-Rule:MF_01161} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tlr1616; OC=Thermosynechococcus.
Sequence length 344
Sequence
MWGIHHARLHTTLKTQQWLPLGSRILIALSGGQDSVCLTRLLLDLQPHWQWSLVAVHCDH
RWRADSTANANFVQQLAQKWHLPCEVVSAPDLPKTEAAARSWRYQVFESVAKALDCTHVV
TAHTQSDRAESLLLHLLRGTSPDGLATLLPSRSLGAIQLVRPLLGMTRAQTAAFCQAYGL
PIWQDETNHNLEYRRNRLRLELIPYLQQHFNPNVEEALAQTAELLASDRAYFEAEVERLA
PTVLREHPPALDRLRLREFPLALQRRLIQCFLRQHLKRGLNFRVIEAVRALMTTGNGSQT
ASLPGGQHLRVCGRWIELVRPMPPPPAPVPPDPGERSPPPSPLY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]