dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q97AA4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q97AA4|Q97AA4_THEVO) Galactokinase {ECO:0000313|EMBL:BAB60048.1} KW=Complete proteome OX=273116 OS=15438 / GSS1). GN=TVG0927911 OC=Thermoplasmataceae; Thermoplasma.
Sequence length 324
Sequence
MIITKTPLRITFVGGGTDIPEYYRKKGGAVVSAAINKYIYVIVNKKFDNKIRISYSKTEM
VDSVEDIEHPSVRESLKLLGIDGGIEILSISDIPSKGTGLGSSSTFLVGLLNALHAYKGE
LTSREELAREAVLIEREILKEPGGKQDQYMAAYGGINLMNFNQDESVYVRPLSINAKSLE
DFRNHLLLLYTGIQRNSTDIHKKQREEVIKKEEYYDEMKELAYTFFEAVYKAEYPRIGAI
MDANWKNKKKLTDGISNDIIDNLYELAMKKGAYGGKLIGAGGGGFLLFVCEPSDSDDIIK
ALSLRKIDFDFDFEGSRIIYVSKD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]