dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q9ER04 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|Q9ER04|TMPS5_MOUSE) Spinesin KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Tmprss5; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence length 455
Sequence
MSPTLDDQSPMEIRCTEEGAGPGIFRMELGDQRQSISQSQRWCCLQRGCVILGVLGLLAG
AGIASWLLVLYLWPAASPSISGTLQEEEMTLNCPGVSREEELLPSLPKTVSFRINGEDLL
LQVQVRARPDWLLVCHEGWSPALGMHICKSLGHIRLTQHKAVNLSDIKLNRSQEFAQLSA
RPGGLVEESWKPSANCPSGRIVSLKCSECGARPLASRIVGGQAVASGRWPWQASVMLGSR
HTCGASVLAPHWVVTAAHCMYSFRLSRLSSWRVHAGLVSHGAVRQHQGTMVEKIIPHPLY
SAQNHDYDVALLQLRTPINFSDTVGAVCLPAKEQHFPWGSQCWVSGWGHTDPSHTHSSDT
LQDTMVPLLSTYLCNSSCMYSGALTHRMLCAGYLDGRADACQGDSGGPLVCPSGDTWHLV
GVVSWGRGCAEPNRPGVYAKVAEFLDWIHDTVQVR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]