dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q9RZT8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q9RZT8|Q9RZT8_DEIRA) Sigma-B regulator RsbS {ECO:0000313|EMBL:AAF12579.1} KW=Complete proteome; Reference proteome OX=243230 OS=LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422). GN=DR_B0025 OC=Deinococcaceae; Deinococcus.
Sequence length 141
Sequence
MDRLPILKLGDCLLVTIQVELHDRLALTLQDDLTTMIANTGARGVLIDISALDIVDSFIA
RVLGNIAAMSRVLGAETMVVGMQPAVAITLVELGVTWQHMHTALSVERGLERLKVLIAER
HTLRGHSPRGKRGGGVDGSRH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]