dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q9VA69 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q9VA69|Q9VA69_DROME) SD05564p {ECO:0000313|EMBL:AAK93533.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG31022 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence length 550
Sequence
MAADWRLMLLLGILLLVGGPANGEVYTALAEMEELLETESVLITNLEGYIRVQEDKLNFL
KNKMDEYQREHSDASHDITAYVSNPINAYLLTKRLTTDWRQVENLMEHDVGTDFLQNITQ
YRSLLKFPSDEDLNGAAVALLRLQDTYQLDTSSVARGKLNGIQYSTEMSSDDCFELGRQS
YVNHDYYHTVLWMNEAMARMLEEPTNHTQSFTKADILEYLAFSTYKEGNIESALTMTNEL
LQLLPHHERANGNKRFYEKEIAQQLQLRKMKGDDGTDEMPKSDLPVAKSDPAIFDMTERR
AYEMLCRGELKPSPSDLRSLRCRYVTNRVPFLRLGPLKLEEVHADPYIVIYHDAMYDSEI
DLIKRMARPRFRRATVQNSVTGALETANYRISKSAWLKTQEDRVIETVVQRTADMTGLDM
DSAEELQVVNYGIGGHYEPHFDFARKEEQRAFEGLNLGNRIATVLFYMSDVEQGGATVFT
SLHTALFPKKGTAAFWMNLHRDGQGDVRTRHAACPVLTGTKWVSNKWIHERGQEFRRPCD
LEEDHGEFAI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]