dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

R0IVX8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|R0IVX8|R0IVX8_SETT2) Uncharacterized protein {ECO:0000313|EMBL:EOA88945.1} KW=Complete proteome; Reference proteome OX=671987 OS=(Exserohilum turcicum). GN=SETTUDRAFT_168156 OC=Pleosporaceae; Setosphaeria.
Sequence length 265
Sequence
MADPIDSALDLLRRLDPKDVKRNVDHIIQLNPSLEEDLLESVDIPLTVKKCSKTKRDFLC
CDYNRDGDSWRSPWSNEFEPPIDEGVTPSDRVRKMEVKANEAFDVYRELYFEGGISSVYL
WDMDDGFAGCVLLKKAVSPTPKSSGSWDSIHVFDAQDRARTSHYKLTSTVILSLGTDSES
LGGLDLSGNMVRQVEADMAVEDDTSHVANIGKMVEDMELKMRNLLQEVYFGKAKDVVGDL
RSLQSLSQANKDRATQREMINSMGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]