dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

R1B868 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|R1B868|R1B868_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD05828.1, ECO:0000313|EnsemblProtists:EOD05828} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_417097 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence length 162
Sequence
MTDYTPKAAQDKQVNHGVYVQPTEDGNFGLDKDIADNAKKKYDFAKEQEVRTWIEKVGVK
LEDGLGALELQKVLQSGVVLCQLANKIKTGVCKLPRSTTQPAVQRENISFYLEACKKLGM
TDNFIFMTDNLFQDRLVELAMMSVINNLCELKNIAEKSSPAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]