dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

R1EIA9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|R1EIA9|R1EIA9_BOTPV) Putative exocyst complex component sec5 protein {ECO:0000313|EMBL:EOD47272.1} KW=Complete proteome; Reference proteome OX=1287680 OS=(Neofusicoccum parvum). GN=UCRNP2_5989 OC=Botryosphaeriaceae; Neofusicoccum.
Sequence length 1015
Sequence
MPAQMERQLLEHYNLKTLYPSEWPQEKDEAEDSDDEAQPSRQSAAIVRRRSRYSVLERSG
VRSSVLNTEKTKEGVDTLVQKDEADPLGNASSVVNVLRQRGLPVEDDLKLRNRFLLSSTT
FNPGLFLSQVHSDASTESLLQGLDFLSRSIEKKSASLKVLVESNFERFVRAKTTIDNVYM
EMRDQRSDAQPASHSRTGSRQFSGRQSGHYRRASQALIAPGQAPAGDKRKTALTKESEYG
VQGIKAPLLEVAVKAEEIWGPALGGRERGEMLKSILSSVERHRNLFEIGASIQDCIKRRD
YDILPEEYNKARRYASDAKKIVEMSVDNRTAMTDPEIHQVIVTARMWTDVEEQIAVFKRD
VWKRLAGTHFTKQAPSEDEKPEQHMTLIKVLLELGVEDNPIWVWLLSRYDFLKQKITATL
ERSKVELEILRRRLGNGEKPTPRQIATYLRAAEHLEKPNHSTKMDSTKIIDFWDHELQSL
NAILSPQGGVLGEVIEYWETAQSFIDGKAQRTLPVGPEGQSKAHHRLSSSGVMDLQGGAK
ELVNLIREGVQSFFTEAPIDDISLLYSPIPDTPATPRTPMPGPLTPSMDSRFKIDSSNPP
PSPRTGAGWEKYAFWAPYANSLSGVHYLSKILVLVGSAASEIAAMRITRDGTRSSEELKL
FVGTIRERCVQSVCAAWGEDADYAKLLEDWTRWSDNKYLTNMPFRFVALDNSLLAIMQKM
LYLSEAMTRSSAGEVVVPPSSKLLAMVKSQFVTSIYKVLQGMVENVERPKNLDNSGWEDD
VDGLTLPLRTLTTRDISSNAVDATDKNIRILLTLSNLQALRTDLIPQLISQYEQHFSVKL
EEGAKIDDALSQIYARLFQSYTSPISTKLAAIIREGIAAPGWEPDTNRPADARAYVYDVL
LELVVVHTQVSTTAAPLTSQILKYLLEQVSKHLIENFKARPRYTLAALMQATLDVEFLAQ
TLGNYTTDKASEIQSAIYLALDERTDNDARVKLQTELGGLRVILKKLREATKSEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]