dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

R4ZE98 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|R4ZE98|R4ZE98_9POXV) Uncharacterized protein {ECO:0000313|EMBL:CCU56142.1} KW=Complete proteome OX=1293539 OS=Choristoneura rosaceana entomopoxvirus 'L'. GN=CHREV_240 OC=Betaentomopoxvirus.
Sequence length 225
Sequence
MINFKYIYTNIIYYINIYFIQYIYINIIFPFKKYIFLNQNVEILELLFNDEMNTFYVNIY
KLFKNNNFINVINKLKEILDMKRDIINIESINNIFSTISNELDENYPDKINFILNHRLMP
NLIDEIKNILNLSNLDNSNNINDIIISLIDDVINIINNDDDTKNVLYEFFKIYNNDNKTI
ECLRNYIDNEIISEIVFVIIKNLLNLYLKMRVDNININNTSVANI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]