dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

R5V0A6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|R5V0A6|R5V0A6_9BACT) NADPH-dependent FMN reductase {ECO:0000313|EMBL:CCZ76806.1} KW=Complete proteome; Reference proteome OX=1263035 OS=Alistipes finegoldii CAG:68. GN=BN754_02314 OC=Alistipes; environmental samples.
Sequence length 179
Sequence
MAKKVLILSSSPRRGGNSDLLCDRFMAGAQQAGHDVEKIFLRDKKINYCTGCGVCYGGAK
PCPQRDDAAEVVGKMIGAEVIVMATPVYFYTLCAQMKTLIDRTCARYTEMGGKEFYFILT
AAEESVEMMERTVECFRGFLDCLDDPEERGVVYGVGAWQAGEIEGMPAMDEVYELGRRV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]