dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

R7WA27 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|R7WA27|R7WA27_AEGTA) Auxin response factor {ECO:0000256|RuleBase:RU004561} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_02482 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence length 858
Sequence
MSNPTTINCLYNMKTVARDFALQLWRVASPYPRNHVHLTVPSQPRSPRRTLEATFTSPLE
EDEVDIEGGSSFFADELATQANANKKRQSIQTKAYTKDEDKLLCECWRDIGQDPKIGAEQ
KAPTFWLSVHRQFHECKKFAPYKMESKRGWVSLSKRRRVIQQECNKFCATLESIEGRPMS
GFGIKDMAFQALEAFKAQHGNKPSTLTYCWMVIKGDEKFKEQYVALRKSGGLEAVEEHGV
GEKPRPRGKTNSKTDDERAASSNQQKANKMRVCLDRRVALKSKEKADPATDEVYARLALV
AEGEVFEKNMGGGRFEGEDDMEDGDGERKSRMLHMFCKTLTASDTSTHGGFSVPRRAAED
CFPPLDYQQIRPSQELVAKDLHGAKWRFRHIYRGQPRRHLLTTGWSSFVNKKKLVSGDAV
LFLRGDDGELRLGVRRAIQLKNEALLKAFNSNSSKIHTLSAVANSLKHRSVFHICYNPRA
AASEFIIPYWKFLKSLNRPFCIGMRFKIQYGSEDVNERRSGMITGINDVDPIRWTGSKWK
SLLVRWEDGTDCNSQNRLSPWEIEIVGGSVSIAQSLSASSSKRTKLCPQGNVDVPTLYGN
GRPDSVGADKLPRVLQGQELMGSGTHRVTCPPQPGGATEFRRSDGTGFLANTRSCMLSGP
ASRFPPQSPYFAYQPVGFGESVGFPEVLQGQEVSQTVPLFQGIVSDTCSAKGGYGLYNYM
RPSSAMNGGFSSAAQGYPLSLSTPPPAEAASPSSAALWLASKSNEEAANGSQLNQFGIPK
SPGDGAAKLGSDGRKVARTSCMLFGFSLTEKMLPTEEDCAKEGSHEADCQNPRMLDLFGY
NRATPGALHALCAAPLGI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]