dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

S0B4M5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|S0B4M5|S0B4M5_ENTIV) M protein, serotype 24, putative {ECO:0000313|EMBL:BAN41506.1} OX=33085 OS=Entamoeba invadens. GN= OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence length 318
Sequence
MAEQQANVEQIANLETAKAALNAEIAQLQQTKANITGEIDGLNKTKEATTSEINTLQTNK
CAIEEQISNAKKELLEVEEEIKKKKTPDEREANIIEQENHYLELNTMFEQLVKQNEENKT
IFEAKQTELQKSLDESKILKEHLDSENNKLDVTMKQTETLKKEYEIKIQDAKDAIASYEK
QRKIYEDQNKLIIAAQNVLQMQIKREKEKYTENQKLIENSKIIYQKFEQQNEQLNNLLDK
TKEERELLSKQKDEFEKNNEEVFKKRLDNVKKEDDLNRREKTIKCAELKIEKIPDVVEEI
KVEKVEKKEDVPPPQQPQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]