dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

S0DIM0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|S0DIM0|S0DIM0_GIBF5) Probable F-actin capping protein beta subunit {ECO:0000313|EMBL:CCT62065.1} KW=Complete proteome; Reference proteome OX=1279085 OS=(Bakanae and foot rot disease fungus) (Fusarium fujikuroi). GN=FFUJ_01420 OC=Fusarium; Fusarium fujikuroi species complex.
Sequence length 282
Sequence
MAVDPFDSALDLLRRLNPKQTTDHLNAIISIAPDLTEDLLSSVDQPLTVRRCKQTGRDYL
LCDYNRDGDSYRSPWSNQFDPPLDEAGSGGVGAGGNEGAGEGAIPSERVRKMEVKANEAF
DVYRDLYYEGGVSSVYFWNLDDGFAGVVLLKKSSPQGGNSEGVWDSIHVFEAIERGRSTH
YKLTSTVILTLSTAGGNLGEMDLSGNMTRQVEQDLPVDNDDSHIANVGRLVEDMELKMRN
LLQEVYFGKAKDVVGDLRSIGSLSEGARDREAQRELIGSMRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]