dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

S4EVG5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|S4EVG5|S4EVG5_ENTFC) CHAP domain protein {ECO:0000313|EMBL:EPI23566.1} KW=Complete proteome OX=1244152 OS=Enterococcus faecium SB2C-2. GN=D354_01035 OC=Enterococcus.
Sequence length 345
Sequence
MKPVTPTAPAEKPVEQPAASTPQPEIVPPVTNETVGLVEDDETFTVSKTKKTEEFIQEIG
ESARKVAKDKNLYASVMIAQAILESGSGNSKLSQKPNYNLFGIKGDYKGQSVSFITYEDN
GFGNLYTVEAKFRQYPTYKESMEDYAKLLKNGLDSNKNFYHGVWKTEAKSYKEATRFLTG
KYATDKDYHKKLNALIKTYDLTYYDKEKATVEPMESNFPAYNGKNYDTFNSYAWGNCTQY
VYNRITQLGKRVDLTMGNGQDWGETGRARGYKVSRTPKAGAAVSFPAGVLGADNTYGHVA
FVEKVFKDGSILISEMNVKGLNVVSTRTISADETHLMNYIVPKDK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]