dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

U1K877 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|U1K877|U1K877_9GAMM) Peptidase M14 carboxypeptidase A {ECO:0000313|EMBL:ERG43099.1} KW=Complete proteome OX=1117318 OS=Pseudoalteromonas rubra DSM 6842. GN=PRUB_21143 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence length 745
Sequence
MKKNLLGMLLLSTISVTATAHSDPHVAHVQALSADNHTLSTYQLAFSSETQKAEYLSRFH
TAILEVANNYLVLSLTQQEFAELHSAGALIFSKPGESNQSEAAVQGDISAISRAQSTVPE
SGIPNFSCYPTLAETQQMAQTLAQTYPDFVELKHIGPSWEKSQGLGGHDLTVLVLKNKKK
NKWRKRPALYMQGALHAREYTPGATTLKFAQYLLENRETDADVNWILNQREIHILLIANP
DGRVLAEQGQFWRKNTNTAYCALDETLRGVDLNRNFDFAWASPIGGSTDDQCAATFHGPS
PASEPETQAIQAYLHDLFKDRRGDLLTDPAPLNTQGVFLDLHSFSRFVMWPWSSELTPSP
NADQLSMMGHRMAAYNGYWAFQTQEIFKAGGSADGYAYGQLGVASFTFELGNEFFESCAN
FEGEIFPNNLNALIYAAKVAKRPYKLPAGPQFFDLRLKGAGKEAVPAGTPVEIIATVADD
LFGPSLTGQVPPSQAISKVELTIKKKGKRGRKRILLPAADGAFDTVSESLNYTLDTHRWR
KGRYTLTLRAQDASGQWGPKYAKFLTIDNEAMPGTQSPVADFIADCRKGICGFDGSATQD
DRDSLTYTWVLQGGQFFRVFHGEQVEIEYTLAGDYQLTLQVDDSHGNRDVKVVQLELDGV
TPPVVQFDYQCTGLTCEFNSSASYDPDGEIVERLWRMGNEPYIPGVETVVHTFAAPGEYI
VVFVAIDNDGQFSQVAQTIQVTSNE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]