dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

U3I0W4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|U3I0W4|U3I0W4_ANAPL) Cullin 4A {ECO:0000313|Ensembl:ENSAPLP00000000884} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=CUL4A OC=Anatinae; Anas.
Sequence length 708
Sequence
ERPKLPDNYTQDTWQKLHDAVIQSSVSIRYNLEELYQAVENLCSYKVSATLYKQLRQVCE
DHVKAQILQFREYSLDSLLFLKKINKCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPSIW
DMGLELFRNHVISDKQVQNKTIDGILLLIERERSGEAVDRSLLRSLLSMLSDLQVYKESF
EQRFLEETNCLYAAEGQRLMQEREVPEYLHHVNKRLEEEGDRVITYLDHSTQKPLIACVE
KQLLGEHLTAILQKGLDNLLDENRISDLTQTYQLFSRVKGGQQILLQHWSEYIKNFGTTI
VVNPEKDKDMVQELLDFKDKVDHIIEVCFQKNEKFINLMKESFETFINKRPNKPAELIAK
YVDSKLRAGNKEATDEELERILDKIMIIFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDA
EKSMLSKLKHECGAAFTSKLEGMFKDMELSKDVMVQFKQYMQNQSDPGNIDLTVNILTMG
YWPTYTPMEVHLNSEMIKLQEVFKTFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQV
SLFQTLVLLMFNEGDEFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKNPKGKDVEDG
DKFIFNGDFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLG
HNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]