dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

V4HRV5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|V4HRV5|V4HRV5_9GAMM) Zinc carboxypeptidase {ECO:0000313|EMBL:ESP90654.1} KW=Complete proteome OX=1353533 OS=Pseudoalteromonas luteoviolacea 2ta16. GN=PL2TA16_01758 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence length 744
Sequence
MNKNIIKAGVLSALSMVTTSAYTHNQKTPEQALNLQTNQSNYLLYFDSPEQKAHYSGLYH
EQIIDASHNAFKLSLSKAEYRTILQTGVIIVEQNVAESFAAPALPKTKKSMSITPSSGAE
ELTSIPNFPCYPTVEETHKRAQQLAEKYPDFVELKTIGPSWEKSQGIGGYDLNVLVLKNK
KRNKNKQLPALFMQSVLHAREYTPGATTLRLAEHLLENRKTDADIHWILNQREIHILLIA
NPDGRKYAEQGLFWRKNTNASYCAQSEQNRGVDLNRNFDFAWATTSGSTDEQCASKFHGP
SPASEPETQAIQAYVKALFGDNRGDALNDAAPLDTPGVFIDIHSYSRFVMWPWSHETTPP
PNAAGLSMLGHRMAAYNDYLALQVSEQFNGGGSAEGYAYGELGVAAYTFELGSTFFENCS
NFEGEILPNNLQALIYAAKVAKKPYKLSGGPKIVDFRLEGAGETAVPAGTSINLIADVHD
DAFGPSLSGVAPPSQAIKKVRMTVRKQGEGRIQRLILPPVDGIYDSPREKINYALDTSDW
DDGRYTVIIKAQDTTGQWGVKYAKYLTIDDDASEQNQAPIANFTPNCTFGACKFDASNSI
DDKAGLKYRWYISNDATQFEYFGKQIEFVNQRAGTYTIALEIEDANGVRANKEVVMELQG
TVPPIAKLTYQCNGLTCEFDSSGSTDADGQIVRRLWRIGSDDGFADGDVKVTRTFPAPGE
YIVSVVVLDNHDEYSQVIETITVK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]