dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

V5RSS1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|V5RSS1|V5RSS1_9BACT) Phenylalanine--tRNA ligase {ECO:0000256|SAAS:SAAS00385312} KW=Complete proteome; Reference proteome OX=1394710 OS=candidate division WWE3 bacterium RAAC2_WWE3_1. GN=P147_WWE3C00001G0439 OC=Bacteria; candidate division WWE3.
Sequence length 620
Sequence
MNVLIPFSWLKDYVKTNAGIRDVAKALSEHSFSVEKIIDDDTLEIEVTPNRGDGLSVLGI
ARELAAVLPVKGFSADWVKKSFPVKKYSGRDKLKVKISDNSLVPRFSAVVIDKVKVKESP
ALVKERLSKVGIRAINNIVDVTNYCMIELGQPMHAFDYNKITGHEMTVRESKRGEEIVTL
DGVKRVLPEGVIVIEDGDGRLIDLCGIMGGLNSEVDENTTKVLLFVQVYDPVRIRKSSMS
LGHRTEAALRFEKGVDFESVIPSLQTAVGMLTELSGGEVSSELIDLTGTVYTKKHIKIDY
EKINKIAGTEIKKDFVNSTLTSLGFVIKGSDVYVPSWRYDDIEIIEDLAEEVIRIYGYQE
LPNELPGGTLPHHTKTDNFALEDKTKDFLKHMGFFECYNYSAVPGSMAGHGALKVKNPLN
ADLEFLRTSLTPKLLDVLNKNKGYSETVKLFELSSVYLAKKGDLPEQPYMLGMVARGVDF
LVFKGIVEALFEELGVTGDFPYEITEHSGAIISCELPFDKMVDSAGGSRVYSPLTGFNSI
KEDITIIVGDATSFSEIVSVVSSTDVRVNKVGFKDMYEDALTLSIEFLDRAKQITSEETK
GIRDAIIKNLDSKYGIKLKV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]