dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

V7D504 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|V7D504|V7D504_9PSED) 2,3-dehydroadipyl-CoA hydratase {ECO:0000313|EMBL:ESW36605.1} KW=Complete proteome OX=1388762 OS=Pseudomonas taiwanensis SJ9. GN=O164_28815 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 257
Sequence
MPRYLDVQAPEQGVQLITLQRPEALNALCTELLAELAAALEAAGQDEQTRAVVITGSRKA
FAAGADIREMAERDLVGILNDPRVAHWQSIAAFAKPLIAAVNGYALGGGCELVMCADIVI
AGSDARFGQPEINLGIIPGAGGTQRLLRAVGKPLAMQMVLTGEAITAPHALQAGLVSEIT
QPELTVERALHIARGIAAKAPLAVRLAKEALLKAGDTDLASGLRFERHAFTLLAGTADRD
EGIRAFQEKRQARFQGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]