dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

V7DDX3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|V7DDX3|V7DDX3_9PSED) HTH-type transcriptional regulator BetI {ECO:0000256|HAMAP-Rule:MF_00768} KW=Complete proteome OX=1388762 OS=Pseudomonas taiwanensis SJ9. GN=O164_05460 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 218
Sequence
MPKVGMQPIRRQQLIEATLQAVDQVGLGDASIALIARLAGVSNGIISHYFRDKNGLIAAT
MGYIMNMLNEGVRARRQALTDDSPRAHLKVIIEGNFDASQVNGPAMKTWLAFWASSMHQP
DLHRLQRINDHRLYSNLCCQFRRALPLYHARKAARGLAALIDGLWLRGALSGDAFDTDQA
IRIAYEYMDLQLAKQHTLGTNDQAAEQPRTALANPAGA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]