dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

V7DFR8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|V7DFR8|V7DFR8_9PSED) Transglycosylase {ECO:0000313|EMBL:ESW41197.1} KW=Complete proteome OX=1388762 OS=Pseudomonas taiwanensis SJ9. GN=O164_01695 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 81
Sequence
MGIIGTIFIGLIVGLLARFIKPGDDSMGWIMTILLGIAGSLLATYGGQALGIYQAGQAAG
FLGALVGAVILLLIYGFIKKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]