dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

V9IH62 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|V9IH62|V9IH62_APICE) F-actin-capping protein subunit beta {ECO:0000313|EMBL:AEY59836.1} OX=7461 OS=Apis cerana (Indian honeybee). GN=ACCB05249 OC=Apoidea; Apidae; Apis.
Sequence length 273
Sequence
MTEQQMDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIAKDKESGKDYL
LCDYNRDGDSYRSPWSNTYDPPLEDGSMPSERLRKLEIDANHAFDQYRELYFEGGVSSVY
LWDLDHGFAAVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRIAHYKLTSTAMLWLQTN
KHGSGTMNLGGSLTRQVEQDAQISENSPHIANIGRMVEDMENKIRNTLNEIYFGKTKDIV
NGLRSVQSLADQRQQAALRQDLAAALQRRNANN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]