dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

V9UY86 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|V9UY86|V9UY86_9PSED) Membrane protein {ECO:0000313|EMBL:AHC87626.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_09455 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 299
Sequence
MQSHFSKGLLFALCAAALNATIGVLSKVLMNSGFSSSSIALIKTVLGCLLLSALLLFLKR
PLHTAKWFHAAVCAFLGIFVLFHFETSAYSHYAAAGVVVILMASASISSILLGRIVLKDP
ITANATVGAGLTIAGIAVIFGADLDQGFTLQGAMLAATGGCGYGAFSVAMKRMGVSGGLH
FTRQLLFFGSLYLLMPAATDGFIIGELSPGAVLALLALAALPTILGFFCTTKAIEYLKPS
QVQALELTEPLFAALLAFVVLNEVPRDTLYLGAGLILFGLCFSNELIRLGKKAPQPSKA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]