dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

W3XPT4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|W3XPT4|W3XPT4_PESFW) F-actin-capping protein subunit beta {ECO:0000313|EMBL:ETS87241.1} KW=Complete proteome; Reference proteome OX=1229662 OS=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140). GN=PFICI_01069 OC=Pestalotiopsis.
Sequence length 283
Sequence
MAADPFDSALDLLRRLNPKHTTQHLQSLISLAPDLTEDLLSSVDQPLTIRRCKQTGRDYL
LCDYNRDGDSYRSPWSNEFDPPLDGGVGDGGAGDGAGAAGVPSDKVRRMEVKANEAFDVY
RELYYEGGVSSVYFWNLDDGFAGVVLLKKEAKPGSTSEGSWDSIHVFEAIDRARVTQYNL
TSTVILSLANSGSGLGDMDLSGNMTRQVETELPAENDEQQIANIGKLVEDMELKMRNLLQ
EVYFGKAKDVVGDLRSIGTLSEAGRDRQAQREIIGSMNKFSRD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]