dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|549456165|ref|YP_008604924.1| (Aeropyrum camini SY1 = JCM 12091)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment predicted archaeal sugar kinase [Aeropyrum camini SY1 = JCM 12091]
Sequence length 326
Sequence
MFNAVRISAPSHVHAGNYDIEGSIGRLYGTVGLALEEPRLVLEASPGRGVEVLGGGRRGD
VERFARLYLEKAESRGCSVGGVRLRIHREIPAHVGLGSTTALALSIGASVYRICGIEPLD
LKELAVAAGRSLVSALGLYSFEQGGLIVDGGFVRGERRPPPLVFRMHVPRSVRVVAALPE
RPIPRILDIKRREEELLSRMPSMDPGMAGWASRVVLLGIMANAAEGRWGDAARWMGEFNR
RLGEYWAGEQGGVYCCSEAEEIISAIVDAGAWSGLQSSWGPTVYGLVPARRVSDVVDAAR
KAVEKVGGGRVWATSVDNVGAVISSV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]