dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

URET_04321 (Uncinocarpus reesii 1704 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | UREG_04321 | Uncinocarpus reesii 5-aminolevulinate synthase (632 aa)
Sequence length 631
Sequence
MEALLHQSRSLCPFLKRTSPSTLRSLSSSTRPQAAASPGGGTISNLQVIARRCPIMSKAL
AVQSARMAGAGGCPMKGLRGLHTSAVRQASVREVGGKKADRVPPALSNLSSIPSPSAAMK
RDTVCPGPKPAAPPAGKFDYEGFYSGELEKKHKDKTYRYFNNINRLAREFPQAHMSSPGD
KVTVWCANDYLGMGRNPYVLQSMHETLDSYGAGAGGTRNISGHNQHAVRLEDTLAKLHRK
EAALVFSSCYVANDATLATLGSKLPDCVILSDSLNHASMIQGIRHSGAKKMVFKHNDLAD
LESKLASLPPSTPKIIAFESVYSMCGSIAPIEEICDLADKYGAITFLDEVHAVGMYGPHG
AGVAEHLDYDIHATSPENVKGTVMDRIDIITGTLGKAYGCVGGYIAGSAKFVDTIRSLAP
GFIFTTSLPPATMAGATTSIKYQAGYGRDRTLQQLHTRAVKSALNENDIPVIPNPSHIIP
ILVGDAELAKRASDMLLEDHGIYVQAINYPTVPRGEERLRVTPTPGHTKPLRDHLVASLQ
QVWERLGIRKTSDWKAAGGFLGVGDDAAAHDVKNQPMWTDEQVGLNKGEDIEVALQRELK
AEAVARQCILNELAEPTRMAAATAQPVSVAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]