dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

URET_05021 (Uncinocarpus reesii 1704 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | UREG_05021 | Uncinocarpus reesii conserved hypothetical protein (664 aa)
Sequence length 663
Sequence
MEDSARQKKGFGKVVVALSRRCLRWPKRRLMVLVRRRKKSQVTRSSGEHQLVSANNTSHH
DHHDANGNALEHGLLSSTDTIMSVAKQKIINSAQGGAEEGPGSQLLSGGESSAAKGDESS
ANASAAMNGGAENKNRKKQEAKGGPEAKQGAEKKDSQQQQQQQQGEGPPKLSNAELKKRA
KAEKAARRAKEKQEREGEQAASAQLQNQQQQAKKGGGGGGGAGKQKQGAPAAGTKQAAQR
RGSVHVPAVESKKKKKSENENIVAVFGHLPWHSRRAGIAGVGKEIHPAVVALGMQLRDYV
ICGSSARCVATLLALRRVVQAYITPIGTSLSRHLTTYLSHQINYLTTCRPLSISQGNAIR
ALKLEITTIDPGDSEDEAKQQIYDYIDNYIREKYTVASQVIANSAADRIKDGDVILCYAG
SSVVQKALLTAHAQGKKFRVSIIDTRPLFEGRNFARTLSKAGLEVQYSLINGITTAIRDV
TKVFLGAHAMTSNGCLFSRVGTALVAMSAKERVGGINIPVIVCCETAKFTDRVALDSIVV
NEIADADELVAVEAPEQVTNLSPPTPAPTGKGGKAASTASSATNADTGSIASSLGPTSLV
TDPSQPLQNWREMKNLQLLNIMHDVTPAQYIDMVITEMGSLPPSAVPIVHRMSTESEEKD
AKH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]