dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTTRP00000003483 (Tursiops truncatus 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection scaffold:turTru1:scaffold_114816:253410:274000:-1 gene:ENSTTRG00000003711 transcript:ENSTTRT00000003710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 487
Sequence
MAGTRALLMLENFIDGKFLPCSSYLDSYDPSTGEVYCRVPNSGKEEIEAAVEAARAAFPG
WSSRSPQERSQVLQRLADLLEQSLEELAQAESRDQGKTLTLARTMDIPRSVQNFRFFASS
ILHHTSECTQMDHLGCLHYTVRTPVGIAGLISPWNLPLYLLTWKLAPAIAAGNTVIAKPS
ELTSVTAWMMCKLLEKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLEECVPTTVRSSFANQGEICLCTSRIFVQKSIY
SEFLKRFVEATRMWKVGIPSDPSADMGALISKAHLEKVRSYIKKARMEGAQILCGEGVDK
LNLPLRNRAGYFMLPTVITDIKDESCCMKEEIFGPVTCVVPFDSEEEVIQRANSVKYGLA
ATVWSGNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGVGREGAKDSYEFFTEI
KTITIKH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]