dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTTRP00000006651 (Tursiops truncatus 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2310:467:2332:-1 gene:ENSTTRG00000007035 transcript:ENSTTRT00000007031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 119
Sequence
KKDKKPKKSTWKFNLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERFKSK
ITVASEKQFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDGSESED

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]