dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|543962453|ref|YP_008545488.1| (Sulfuricella denitrificans skB26)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 50S ribosomal protein L11 [Sulfuricella denitrificans skB26]
Sequence length 143
Sequence
MAKKIIGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGLEVGLPIPVVIT
AYADKSFTFIMKTPPATVLIKKASGVQKGSPRPHTDKVGKLTRAQAEDIAKAKMPDLTAS
DMDAAVRTIAGSARSMGIEVEGV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]