dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|37678689|ref|NP_933298.1| (Vibrio vulnificus YJ016)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PTS system mannitol-specific transporter subunit IIABC [Vibrio vulnificus YJ016]
Sequence length 667
Sequence
MANRYYNIHQNIKRGILMISPDAKIKIQNFGRFLSNMVMPNIGAFIAWGFITALFIPTGW
LPNETLAAMVGPMITYLLPLLIGYTGGKLVGGDRGAVVGAITTMGVIVGTDIPMFMGAMM
VGPMGGWAIKRFDNYIDGKVKSGFEMLVNNFSAGIIGMLCAILAFFFIGPFVKVLSGGLA
AGVNFLVSAHLLPLTSVFVEPAKILFLNNAINHGIFSPLGIQQASEAGQSIFFLIEANPG
PGLGILLAYMVFGKGTARQTAGGASIIHFFGGIHEIYFPYILMNPRLILAAIAGGMTGVF
VLTVFNAGIVSPASPGSIFAILLMTQKASILGVLASIASATGVSFAVAALLMKTQTSTEE
EGNEAALEKATSQMKNMKSASKGRANVTNQNKSDVDLATVHSIIVACDAGMGSSAMGASM
LRKKIQDAGLNIHVTNLAINSLPESADIVITHKDLTDRARKHAPNAYHISLTNFLDSEMY
NQLVTKLFAAQQLSAANDDNVVKVSVLAANDDTFEAQPPSVFQIQRENIHLGLKANSKEE
AIRFAGNKLVELGYAEPEYIEAMFEREALVPTYLGESIAVPHGTVEAKDRVKKTGIVICQ
YPSGIQFTDDKDDVAKLVIGIAAKNDEHIQVITTITSALDEPEAIERLTSTDDIEEILDI
LGGKQAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]