dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|37679587|ref|NP_934196.1| (Vibrio vulnificus YJ016)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pseudouridylate synthase, 23S RNA-specific [Vibrio vulnificus YJ016]
Sequence length 231
Sequence
MFDILFTHPDFLIINKYPHVSVHKDDGDTMLLQEVAKVSGDEQLYLIHRLDKMTSGILLL
GRNSTAASALSQRFAQREVEKFYLAIGAKKPKKKQGTVIGDMERSRRASWKLVNSKQNPA
ITQFFSLAGEPGERAFLCKPYTGKTHQIRVALKSVGSSIIGDPIYNAGSDSDRGYLHAFC
LGFQYQGEQYHFVCDPRNQPALGEKWNSEALNQAIEQWLTPWQLNWPTINK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]