dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|37681023|ref|NP_935632.1| (Vibrio vulnificus YJ016)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment L-aspartate oxidase [Vibrio vulnificus YJ016]
Sequence length 548
Sequence
MNSFTLDRDFENFMNANREHECDVLVVGSGAAGLSLALRVANHCKVIVLSKGPRSEGATY
YAQGGIAAVFDESDSIESHVQDTLIAGDGICEEATVKFIAENAKECVQWLIDGGVPFDRE
EDDSDDKPRYHLTREGGHSHRRILHAADATGMAMQTSLQDNAHNHPNIHVLERHNALDLI
TEDKIGGDKNKVIGAYVWNRNQEHVETVKAKFVVLATGGASKVYQYTSNPDVSSGDGIAI
AWRAGCRVANMEFNQFHPTCLYHPEARNFLLTEALRGEGAYLRRPDGSRFMPDFDPREEL
APRDVVARAIDFEMKRLGADCMYLDISHKPAEFITKHFPMIHSRLMDLGIDMTKEPIPIV
PAAHYTCGGVMVDTNGQTDLHNLYAIGEVSYTGLHGANRMASNSLLECVVYAWAAAKDIL
KKHKQVDLASSLPSWDESQVTCSDEEVIIQHNWHELRLFMWDYMGIVRTDKRLERALRRI
QMLQQETHEYYSNFRVSNNLLELRNLLQVAELMVRCAMQRKESRGLHYTLDYPEQLENSG
PTILRPEE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]