dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|37681108|ref|NP_935717.1| (Vibrio vulnificus YJ016)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pseudouridylate synthase [Vibrio vulnificus YJ016]
Sequence length 250
Sequence
MAMLEYLPPTDPWTEIIFEDDHILAVNKPSGLLSVPGRLPEHHDSMWSRLQEQYPEIQVV
HRLDMSTSGLMVFAKNKRAEAALKKQFQYRLTHKIYYARVWGHVETDSGMIDLPLICDWP
NRPMQKVCHEHGKPSQTEFQVAKREVHANGAQTTIMRLLPVTGRSHQLRVHMQALGHPIV
GDEFYAQGDAFTFSERLELHAAELSFYHPKSHWLRSLFVPCDFYPDAEEMIFSYFDPARK
LPDYKSLPKS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]