dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Chlvu1|81305|estExt_fgeneshCV_pg.C_10566 (Chlorella vulgaris )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 682
Sequence
MAGSTMTVEEEAGLIPLGYSPPNYYPPEGSASTRLFVKKEPSCTPLWTTIRKKCSLEGGL
PQIPCMRWMRNYNIRTCLMASADIIAGLTVGVMAVPQSVSFAAMAGLPAAYGLYTAFVPV
FAYSIIGSSRHLALGPVALVSLLLNDGLVKAIPGCDINENPNQPVDAHLQQIYNHAAIQV
SLMVAVLYLLLAVLRLGFLCSLLSRPIISAFLTAGALIISSSQVKYIVGYNIPHADRMQD
IVYNLIVRADRFRWMEFAMGLTWIALLVAIKSAPRFHKRVAWMGPLGPITVATLSVTAVW
AGQLEERFGIKVVGPIQAGMPPITVDWWLPMGDNWPRLVLTAGLIGAVSLLEAISIAKAL
AERNGDTVDADQELLGLGVCNLAGAVFCAYPSTGSFARAAGLVNAALIGFVLLCLTPVFQ
HMPLNALAAIVITGVIGLLDFQRALFLLQVSRMDCLVWLATFLGCLFISIDAGLGLGIAL
GLLFLFVRTAFPRIHVLRRLPGSTFFRDAGMYRLQESAEDGRTVVVSSQGPLCFANAQRI
KERLLEFAAGSQDGVACVVLDLASTTFIDATGIEVLTDLLLKAPAKLHVVLADPNTAALD
ILDRAGLLPKLGPERMFVRVHDAVAHCAALAVRSDDLGHPPVQNGQNGHSHAQYIVGSVP
GWREGSSDMNQPLLVHESIDNA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]