dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSPCAP00000000549 (Procavia capensis 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_984:33391:57432:-1 gene:ENSPCAG00000000563 transcript:ENSPCAT00000000582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 755
Sequence
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMGRTGEGAVSLLERRRL
NQLLLPLLQGPDITLSKLYKLIEDSCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDTDMELANR
EENEGKMEKEELDVSVREEEVSYSGPLSQKQAEVFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSL
RYAALNLAALHCRFGHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI
STAQKTAIWRLYGRSTMALQQAQMLLSMNSLESLSAGVQQSNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAVNDGRYHLADSLVAGITALNS
IEGVYRKAVVLQAQNQMSEAHKLLQKLLIHCQKMKNTEMAISILLSVAELYWRSSSPTVA
LPVLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAVLDK
GRAMFLVAKCQVASAASYDPPKRAEALEAAIENLNEARSYFAKVDCKEQIRDVVYFQARL
CHTLGRTQERNRCARLFRHLHQELPSHGVPLVNHL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]