dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSVPAP00000010174 (Vicugna pacos 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3150:117537:236178:1 gene:ENSVPAG00000010925 transcript:ENSVPAT00000010926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 443
Sequence
PDVDKAVEAAQAAFQRGSAWRRLDALSRGRLLHQLADLMERDRAILATLETMDTGKPFLH
AFFIDLEGCIKTLRYFAGWADKIQGRTIPTDDNVCFTRHEPIGVCGAITPXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGVVNIVPGFGPTEGAAISSHPQ
INKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVECAHQGVFFN
QGQCCTAASRVFVEEQVYGEFVRRSVEYAKKRPVGDPFDVRTEQGPQIDQKQFDKILDLI
ESGKKEGARLECGGSALEDGGLFIKPTVFSEVTDSMRIAKEEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINCYNAIYAQAPFGGFKMSGNGREL
GEYALAEYTEVKTVTIKLDDKNP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]