dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSVPAP00000011699 (Vicugna pacos 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3673:1141195:1471457:-1 gene:ENSVPAG00000012587 transcript:ENSVPAT00000012587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 4335
Sequence
MAHAASQLKKNRDLEINTEEEPEKKRKHRKRSRDRKKKSDANASLRAARAGHLEKALEYI
KNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAE
VVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVAL
QQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHI
AAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDG
LTPLHCGARSGHEQVVEMLLDRAAPILSKTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXKVVDKIANPNAKALNGFTPLHIACKKNRIKVMELLLKH
GASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVV
RYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSARE
GHEDVAAFLLDHGASLSITTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGLTAL
HVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTR
QGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVGCHYGNIKIVNFLLQQFAKVNAKTKNGYTPLHQAAQQGHTHIINV
LLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEETMTTTTVIEKHKMNVPETMN
EVLDMSDDEVRKANAPEMLSDGEYISDVEEDAMRDTDYLGPQXXXXXXXXXXXXXXXXXX
XXXXXXXXLRLFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTRELDSDSLRHYSW
AADTLDNVNLVSSPVHSGNLSFMVNARGGSMRGSRHHGTRIIIPPRKCTAPTRITCRLVK
RHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGE
TWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQ
IGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQVPDEIVKKILGNKATFSPIVTVEP
RRRKFHKPITMTIPVPPPSGEGVANGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLT
FIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESS
LRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNF
YAFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKETESDQ
DDEAEKADRRQSFASLALRKRYSYLTEPGMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFSSRTSPV
TTAGSLERSSITMTPPASPKSNINMYSSSLPFKSIITSAAPLISSPLKSVVSPAKSTVEV
ISSAKVSMASSLSSPVKQMPGHAEVALVNGSISPLKYPSSSTLINGCKATATLQEKISTA
TNSVSSVVHAATDTVEKVFPATTAMPFSPLRSYVSSAPSAFQSLRTPSASALYTSLGSSI
SATTSSVTSSIITVPVYSVVNVLPEPALKKLPDSNSLTKSAAALLSPIKTLTTETHPQPH
FNRTSSPVKSSLFLAPSALKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQTDVPEEKP
FQPELPPEGRMDDEEPFKIVEKVKEDLVKVSEILKKDVCVDNKGPPKPKSDTGQSPEDDW
VEFSSEIRERASVYSLSLERVQVKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITTTSCVDVKSRIP
VKNTHRDTTGSVRKPCATHKQEQPEKGKAKQLPSKLPVKVRSTCVTTTTTTTTSTTTTTT
TVKVRKSQLKEVCKHSIEYFKGISGETLKLVDRLSEEDKKMQSELSDEEDSTSRTTSLSE
PSRGGWPSVTTKSARDKKTEAAPLKSKSEKAGSEKRSSRRTGPQSPCERTDIRMAIVADH
LGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTAVLTK
INRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGWQNETSSGDLESPAQARRITG
GLLDRLDDSPDQCRDSITSYLKGEPGKFEANGSHAEVTPEAKTKSYFPEAQNDAGKQSAK
ETLKPKIQGSGRADEAAPSLAAYQKALEETSKFVIEEPKPCVPVSMKKMSRTSPADGKPK
LNLHEEEGSNGSEQK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]