dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gene07997 (Fragaria vesca )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 252
Sequence
MASFTMVFAPMVTTRVNTRVYAATAAKGAGGSKEEKGFIDWLGGVIAKEDQLLEVDPILK
KVEDKSGGTTNDRKNTVVVPPKKKGHKPSLLSKPDPNRLSKTSFGGTSPNHTNPCFDGAQ
SLNFQGLEFDLQGLKSLNPQALSRTSSGHLKACLLSMPKSDSRKLADVVRSPPSHAGDGF
SPSRMTAQASRTVSLLPGLAGDKFSGRIEALDENTIIDQGWPENLSSASPGRREAVLEAC
AVVREGEKPSPA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]