dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|385776400|ref|YP_005648968.1| (Sulfolobus islandicus REY15A)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment shikimate kinase [Sulfolobus islandicus REY15A]
Sequence length 268
Sequence
MQTYGGVSIINALPSWYGSSMAVNLKVKVEIKEGKRDYSKESDLIRVIIDYFKEKYSIPD
IVVDIESELPQKSGLKSSSAVSVALIAEIAKRYNLRNINPPVLSAILSLKAGVSYTGALD
DATASYCGGIAFTYNKMFRIVKLDNSEDDLSVLILARGGRQKSVNLNELRKYNHVFEEIF
RIALKDSLTAMKINGILIANILGYPLDPIEIALKNGALAAGISGNGPSYFAVSRYGEEGP
IYESLKRFGDVIIARPVSLDCKDLSIRD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]