dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

TRIUR3_29627-P1 (Triticum urartu 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel supercontig:GCA_000347455.1:scaffold36474:25282:27563:-1 gene:TRIUR3_29627 transcript:TRIUR3_29627-T1 description:""
Sequence length 508
Sequence
MSNPCECCERKIRFIRKINGNFMHSMVIPEWFVSQLGGKIWRTIKLQAPDGIIYDVGLSE
NMNRIILKFGWAAFLDANEIEENYSLMFRYLGNSLFEVTIFDSNGKEKVSRSHYTDNSSS
SHPGATQSSAGQGSDSDGSQKESLYQYKKSAKMPAIYSSSEEFSEDNFVESEDQQMLSKY
CVFSGRCYLTEAQKAKVLALVKKIRPEILVLVVEMKKSNVKQSGTLVICKDYARKHMPCE
GTNIILQLPRKDKGWKCRFHIRPSGTSDAGRRNLSLGNFVRDNHVREGEICLFEPMTNAK
EKRFTMTVHLVHKAGIYHSPGERTDIGSNHGRTSTKMASAMDEPPTDGEEYSSEHEEHGV
SDHSEGGSEPPFMLADKAYLTRAQEKKVLEKVEEIESEVPLYAAIMSKSNVYRGGGCRYL
VQKSAAGHHRGKSSLISLMLHREGRSGSWPTKMQHSMQHTTHAMRVLKGWTFFARDNRLR
EGDLCLFKLIKNKEPLTMVIHIIRREEC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]