dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Emihu1|353871|fgenesh_newKGs_kg.24__37__EST_ALL.fasta.Contig12366 (Emiliania huxleyi CCMP1516)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 391
Sequence
MTDHHFMSTRVPTKPVSNAVHAGYDGAAKRDDGIPLYGMDKELADKAAAKFDPKMEREAR
EWIEAVTGEALEGTLQEALKSGVVLCALVNALKPGVCKKPSTMKMAFQQMENIAKYLEAC
SALGVPKHDLFQTVSLYENQDMMAVVTNIHSLGRVSGKVPGYGGPTLGAKLADRSVRHFD
EETLRKGRAEQTFLGKGSHGHASQAGTVDTSRNIGKMDKVRGIDGLGTDASVTAVGMGSH
GHASQAGTVDTSRNIGKVDHVKGIGGLGTDASVTAVGMGSHGHASQAGTFDTSKNISKVD
HVKGIDGLGGDGTTTAVGMGSHGHASQAGTFDTSKNIDRTTNIKGIDGLGTDGISQINLG
SHGHATQEGMGKMHGTREIVHQTFGGAAAAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]