dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CJA14400 (Caenorhabditis japonica )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment JA31097 WBGene00133604 status:Predicted
Sequence length 354
Sequence
MTEDQAQCLLWIMGLQSHEHADLRARALRELEHDSRITLTEFTDRLDQVIALRNDADFMG
GPSSTINAVNINRAKQQHHSSRRPSQAHPKSKNSCQSLNTPCYKCGQMHWARDCKLSSNT
VCRNCSKTGHLTKVCKSKRAVNNTIFISQSSARNRNRIYYDVEIEGKKIRMQLDTGAEVT
LMNSKDWMRLNKPKLSQSKINLYTANNELINVKGQFKCNFTLNGHHGSGLCHVTETESLL
GLDWIAQDTTLYQHIIKASVNKISKVVPEAPPDTYKRTPQKMRKEGTTQEALQKFVMSYR
STPLQHLPQHSPHRQSLPKSSPARRLSSNVIVYKYAYTERGETHFTTSHVLEST

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]